Apost - ptn, Notas de aula de Química
diego-padilha-4
diego-padilha-4

Apost - ptn, Notas de aula de Química

7 páginas
19Números de download
1000+Número de visitas
Descrição
Apostila bioquímica - aula Proteínas
30 pontos
Pontos de download necessários para baixar
este documento
Baixar o documento
Pré-visualização3 páginas / 7
Esta é apenas uma pré-visualização
3 mostrados em 7 páginas
Esta é apenas uma pré-visualização
3 mostrados em 7 páginas
Esta é apenas uma pré-visualização
3 mostrados em 7 páginas
Esta é apenas uma pré-visualização
3 mostrados em 7 páginas
UNIVERSIDADE FEDERAL RURAL DO RIO DE JANEIRO INSTITUTO DE CIÊNCIAS EXATAS — DEPARTAMENTO DE QUÍMICA SETOR DE BIOQUÍMICA Profº. Catarina De Nigris Del Cistia PROTEÍNAS - ESTRUTURA E FUNÇÃO Considerações Gerais & As proteínas, junto a outras macromoléculas (açúcares, lipídios e ácidos nucléicos), compreendem a maior parte da constituição fisiológica do organismo, sendo considerados “os blocos de construção” das estruturas celulares. & Desta forma, são estruturas extremamente funcionais, desempenhando uma série de funções importantes para o bom funcionamento do organismo, como receptores, moléculas de transporte, mediadores químicos, hormônios, marcadores imunológicos e muitos outros. & Possuem uma estrutura tridimensional extremamente interessante e única, que lhes confere propriedades especiais. Não apenas os seres humanos, não apenas os mamíferos, mas todo ser vivo conhecido é constituído por proteínas. & Curiosamente, apesar de toda variedade estrutural das proteínas, elas são constituídas por apenas 20 aminoácidos diferentes, como colocado na aula de aminoácidos, encadeados de diferentes formas, construindo polímeros de pesos moleculares variados. Proteínas - Folding As cadeias laterais dos aminoácidos apolares (abaixo em verde), na constituição de uma proteína, são “forçadas” para o interior da estrutura, enquanto as cadeias laterais polares (em azul) se voltam para o exterior, interagindo (em vermelho) com a água solvatante. Por tal motivo, mesmo sendo constituídas por muitos aminoácidos apolares, dissolvem-se facilmente no sangue e outros líquidos polares. polar nonpolar side chains sicle chains hydrophobic hydrogen bonds core region can be formed to the contains polar side chains nonpolar on the outside side chains of the molecule & O termo folding se refere à tomada de uma estrutura tridimensional, a partir das possíveis interações entre os aminoácidos de uma determinada proteína. Sua função depende de sua constituição estrutural — ela só consegue desempenhar sua função se sua estrutura estiver corretamente “configurada”. Composição das Proteínas & De acordo com sua constituição, as proteínas podem ser divididas em: “+ Simples: Possuem apenas aminoácidos em sua composição. “+ Conjugadas: Contém outros grupamentos além de aminoácidos —- possuem uma parte protéica, denominada apoproteína, e uma parte não protéica, denominada grupo prostético. Exs: glicoproteínas, lipoproteínas, metaloproteínas. Estrutura Tridimensional Protéica & A organização dos aminoácidos em uma proteína (fo/ding, visto acima) se dá em diversos níveis diferentes, e para tanto esta é dividida em algumas classes, para o melhor entendimento: «+ Estrutura primária; =. Estrutura secundária; = Estrutura terciária; “ Estrutura quaternária. Estrutura Primária: & A estrutura primária de uma proteína diz respeito ao encadeamento dos aminoácidos de uma cadeia polipeptídica, ou seja, a sequência pela qual eles estão interligados entre si. Por dizer respeito ao encadeamento dos aminoácidos, as ligações, numa estrutura primária, são sempre covalentes (as peptídicas). —MAAARLCLSLLLLSTCVALLLOPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYG— EL, Sequência de aminoácidos, por sua notação de letra única. Primary protein structure is gequencea of a cnain of amino acnos Amino Acid % A estrutura primária é uma característica única de toda e qualquer proteína. Uma mutação em um único aminoácido provoca uma infinidade de diferenças estruturais. Ela é decodificada pela sequência de bases nitrogenadas do DNA, sendo decorrente de uma informação genética extremamente específica. Estrutura Secundária: & A estrutura secundária corresponde a uma organização espacial localizada da cadeia polipeptídica, formando estruturas espaciais específicas. Esta organização se dá por meio de interações não covalentes, especificamente ligações de hidrogênio. & As duas diferentes estruturas secundárias mais comuns são as a-hélices e as folhas-P- pregueadas. Ambas são constituídas de ligações de hidrogênio entre o grupo amino e o grupo ácido de aminoácidos diferentes, para estabilização. Existem outros tipos de configuração secundária, assim como subdivisões destas, porém estas não serão por nós vistas. &% a-hélice: Se a porção N-terminal está no final da cadeia, todas as ligações N-H apontarão “para baixo” e todas as ligações C= O apontarão “para cima”. O grupo N-H de um resíduo n está ligado ao grupo C=O do resíduo n+ 4. Não há dependência das cadeias laterais dos resíduos, ficando voltadas para fora (a seguir). A forma de visualização mais comum se refere à forma (C) do esquema abaixo. a amino acid fm side chain TA) 1B) (C) &X folha B-pregueada: Também é estabilizada por ligações de hidrogênio entre grupos amino e ácidos, entre cadeias primárias distintas. As cadeias peptídicas estão estendidas, mas é pregueada (e não plana), pois 2 ligações peptídicas adjacentes não podem possuir planaridade (abaixo). Os grupos R orientam-se para cima e para baixo da folha. A forma de visualização mais comum se refere à forma (F) do esquema a seguir. amino acid side chain Es H-bond hydrogen carbon 101 [Er | IF) Estrutura Terciária: & Diz respeito ao arranjo espacial de todos os átomos de uma determinada proteína. É decorrência da realização de ligações covalentes e não covalentes entre várias estruturas secundárias, e sua distribuição no corpo da proteína. & As ligações entre os elementos de 2 estruturas secundárias são geralmente curtas e diretas (sem intermédio de outras forças). Diferente da estrutura secundária, as cadeias laterais dos aminoácidos contribuem muito para o arranjo terciário da proteína. A estrutura terciária, por dizer respeito à forma e organização da proteína no espaço, possui relação íntima com sua função, definindo-a. eysteino X Ligações covalentes: são realizadas entre sulfidrilas livres de cisteínas em tu posições entropicamente favoráveis. Tais as o , = a 1 ———p interchain ligações são denominadas pontes Rê ds Sisuido dissulfeto, sendo responsáveis pela estabilização da estrutura protéica. Não são encontradas no citosol, pois o ambiente redutor não permite tais ligações. Sua formação envolve uma reação de oxidação. intrachain disulfide bond % O arranjo da estrutura terciária cria “domínios”, formados por várias estruturas terciárias diferentes. Uma proteína pode ter vários domínios, um com uma função 4 catalítica diferenciada em relação ao outro. De acordo com sua estrutura 2”, os domínios podem ser: e (A) — ricos em a-hélices (em verde), como em porinas; d+ (B) — ricos tanto em a- hélices quanto em folhas-p (em vermelho), como a maior parte dos domínios protéicos; + (C) — ricos em folhas-p, como em imunoglobulinas (anticorpos) em sua parte variante. 1a) 18) (cj Estrutura Quaternária: co &% A estrutura quaternária é resultante da free assembled structures interação não-covalente entre 2 ou mais subunits estruturas terciárias. Compreendem > dimer subestruturas protéicas, constituindo polímeros, Em: oligômeros e multímeros protéicos, podendo site constar do encadeamento de 2, 3, 4 ou várias (py subestruturas. —» “= binding sites Multímeros podem ser formados de várias (c hetix formas, a saber (ao lado): “. (A) — dímeros; — ing «+ (B) — hélices (atenção: não confundir com e Ali binding a-hélice!) sites = (C) — anéis % Os multímeros podem tomar formas esféricas, filamentosas, ou tubulares helicoidais (abaixo, ao lado). Hama As subunidades podem ser idênticas o ou diferentes, sendo comum a — subunit ocorrência da primeira. " virus coat type Desnaturação Protéica: % Compreende a perda temporária da estrutura terciária, pela quebra das ligações pertencentes a esta. Uma estrutura primária nunca é afetada pela desnaturação. Caso o motivo da desnaturação seja “retirado” do meio, a proteína volta à conformação espacial de menor energia, necessariamente (abaixo). EXPOSE TO à HIGH CONCENTRATION REMOVE OF LUREA UREA —eee —i purifisd protein denatured original conformation isolated from protein of protein re-forms cells Tipos de Proteínas % Dependendo da forma que estão organizados os aminoácidos “no espaço”, as proteínas podem tomar formatos diferenciados, tais como: “ Proteínas Globulares “ Proteínas Fibrosas &X As proteínas globulares (ao lado) possuem formato esférico, constituindo domínios como sítios ativos, o que lhes permite constituir a maior parte das enzimas. Possuem grande solubilidade, e por isso são mais comuns no meio biológico. &% A enzima demonstrada ao lado é a COX-1, complexada a um determinado agente analgésico. Pode-se notar várias estruturas complexadas a esta proteína. & É possível notar que seus domínios são constituídos praticamente por a-hélices (em rosa), estruturas preponderantes em sua organização secundária, bem definida (folhas-p em amarelo). & As proteínas fibrosas são compridas e finas, tais como o colágeno e a queratina da lã. Possuem solubilidade diminuta por aglomerar-se em muitas cadeias, formando fibras. Muitas vezes, não possuem uma estrutura secundária demarcada. Não costumam ter atividade catalítica. Possuem, comumente, subunidades iguais (multímeros), podendo formar grandes cadeias fibrosas, como a hélice de actina (abaixo). aetin helix &% O colágeno (abaixo) é um exemplo de proteína fibrosa. Sua elasticidade é devida à ausência de uma estrutura secundária. short section elastio ritier 50 ofa nm “collagen fibril sa
Até o momento nenhum comentário
Esta é apenas uma pré-visualização
3 mostrados em 7 páginas