EXPRESSÃO, PURIFICAÇÃO E CRISTALIZAÇÃO DE UMA SER THR QUINASE lnls, Notas de estudo de Engenharia Elétrica
igor-donini-9
igor-donini-9

EXPRESSÃO, PURIFICAÇÃO E CRISTALIZAÇÃO DE UMA SER THR QUINASE lnls, Notas de estudo de Engenharia Elétrica

43 páginas
45Números de download
1000+Número de visitas
Descrição
EXPRESSÃO, PURIFICAÇÃO E CRISTALIZAÇÃO DE UMA SER THR QUINASE lnls
40 pontos
Pontos de download necessários para baixar
este documento
Baixar o documento
Pré-visualização3 páginas / 43
Esta é apenas uma pré-visualização
3 mostrados em 43 páginas
Esta é apenas uma pré-visualização
3 mostrados em 43 páginas
Esta é apenas uma pré-visualização
3 mostrados em 43 páginas
Esta é apenas uma pré-visualização
3 mostrados em 43 páginas
relatorio PTP -bv2010

CENTRO NACIONAL DE PESQUISA EM ENERGIA E MATERIAIS

LABORATÓRIO NACIONAL DE BIOCIÊNCIAS

19º PROGRAMA BOLSA DE VERÃO 2010

DANIEL PEREIRA DUARTE

ORIENTADOR DR. MARTIN WURTELE

EXPRESSÃO, PURIFICAÇÃO E CRISTALIZAÇÃO DE UMA SER/THR QUINASE E

FOSFATASE BACTERIANA.

FEVEREIRO DE 2010

CAMPINAS - SP

SUMÁRIO

Resumo.................................................................................................................................4

Abstract ................................................................................................................................6

Introdução.............................................................................................................................8

! 1.1 Fosforilação

! 1.2 Importância Fisiológica

! 1.3 Serina/Treonina quinases e fosfatases

! 1.4 Acidothermus cellulolyticus

Objetivos.............................................................................................................................16

Material e Métodos.............................................................................................................17

! 2.1 Preparação dos plasmídeos recombinantes

! 2.2 Transformação e Sequenciamento

! 2.3 Expressão

! 2.4 Lise celular

! 2.5 Purificação e diálise

! 2.6 Clivagem e finalização

! 2.7 Screenning manual

Resultados..........................................................................................................................25

! 3.1 Clonagem dos genes

! 3.2 Teste de expressão

! 3.3 Purificação em coluna de afinidade

! 3.4 Gel filtração

! 3.5 Clivagem

! 3.6 Cristalização 2

Discussão...........................................................................................................................34

Conclusão...........................................................................................................................38

Referências Bibliográficas..................................................................................................39

Anexo 1...............................................................................................................................41

Anexo 2 ..............................................................................................................................43

3

RESUMO

! A fosforilação reversível de resíduos de proteínas é um importante recurso

utilizado por todos os seres vivos para a regulação dos processos biológicos

frente a estímulos ambientais. Através das Ser/Tre quinases os resíduos de

hidroxiaminoácidos serina e treonina recebem uma molécula de fosfato (PO4),

alterando a carga dessas regiões e modificando a estrutura nativa, enquanto as

Ser/Tre fosfatases catalisam a reação inversa. Por muitos anos acreditou-se que

a fosforegulação não era um mecanismo importante no controle fisiológico em

procariotos, porém recentemente descobriu-se que esses organismos também

utilizam essa ferramenta para autorregulação, assim como já amplamente

conhecido nos eucariotos. As quinases e fosfatases estão envolvidas com

processos de transdução de sinais e sinalização celular que controlam os

diversos processos biológicos, tais como ciclo celular, interação parasita-

hospedeiro, adesão, alteração do citoesqueleto, migração, diferenciação e

comunicação celular. Da mesma forma, em procariotos elas estão intimamente

ligadas à virulência de microoganismos patogênicos, como já caracterizado em

Mycobacterium tuberculosis, por exemplo. Os sítios ativos de tais enzimas

possuem importantes diferenças em relação ao de eucariotos, despertanto

grande interesse para a área médica, visto que o desenho de inibidores

específicos seria uma ferramenta ímpar na quimioterapia antibacteriana. Em 2006

foi concluído o genoma da bactéria termófila Acidothermus cellulolyticus. Por

homologia, verificou-se que esse organismo possui diversos genes “eukaryotic-

like” semelhantes a outros previamente caracterizados como moduladores de

grupos fosfato. O obetivo deste trabalho foi caracterizar, expressar, purificar e

cristalizar duas proteínas de A. cellulolyticus, visando futuramente compreender

melhor a estrutura e mecanismo catalítico dessa classe de enzimas em

procariotos. Os domínios catalíticos das enzimas Ser/Tre quinase (Acel_0019) e

Ser/Tre fosfatase (Acel_0022) foram amplificados, clonados em vetor pQTEV,

sequenciados e expressos em Escherichia coli BL21. As proteínas foram isoladas 4

utilizando uma coluna de afinidade com matriz Ni-NTA, dialisadas e purificadas

por gel filtração. Após, a cauda de histidina foi clivada utilizando a protease TEV

recombinante e a proteína novamente purificada por afinidade e gel filtração. O

domínio Ser/Tre quinase expressado possuía 33,36 kDa enquanto a Ser/Tre

fosfatase 25,31 kDa. Utilizando kit de screening, realizou-se testes de

cristalização utilizando várias combinações de tampões e precipitantes. Alguns

tampões apresentaram características positivas para formação de cristais, porém

não houve formação de um cristal ideal para difração de raios-X e a obtenção de

uma estrutura tridimensional. Um tempo maior de espera é necessário para

formação de estruturas cristalográficas estáveis e ideais, além de um refinamento

dos componentes dos tampões que obtiverem um efeito satisfatório durante o

processo.

5

ABSTRACT

! The reversible phosphorylation of aminoacids residues is an important

resource used by most organisms to control biological processes face to

environmental stimuli. Through Ser/Thr kinases, serine and threonine

hydroxiaminoacids residues receive one molecule of phosphate (PO4), changing

the charge of these regions and modifying the native structure, while the Ser / Tre

phosphatases catalyze the reverse reaction. For many years it was believed that

the fosforegulation was not an important mechanism in the physiological control in

prokaryotes, but it was recently found that these organisms also use this tool for

self-regulation, as has been widely studied in eukaryotes. The kinases and

phosphatases are involved in processes of the signal transduction and cellular

signaling that controls many biological processes such as cell cycle, host-parasite

interactions, adhesion, changes in the cytoskeleton, migration, differentiation and

cell communication. Similarly, in prokaryotes it is closely linked to virulence of

pathogenic microorganisms, as characterized in Mycobacterium tuberculosis, for

example. The active site of these enzymes have important differences from that of

eukaryotes, arousing great interest to the medical field, since the design of specific

inhibitors would be a unique tool in antibacterial chemotherapy. In 2009 it had

been completed the genome of the thermophilic bacteria Acidothermus

cellulolyticus. By homology, it was found that this organism has several eukaryotic-

like genes similar to other previously characterized as a modulator of phosphate

groups. The purpose of this study was to characterize, express, purify and

crystallize two proteins of A. cellulolyticus in order to better understand the

structure of this class of enzymes in prokaryotes. Using the tools of molecular

biology, the catalytic domains of enzymes Ser / Tre kinase (Acel_0019) and Ser /

Tre phosphatase (Acel_0022) were amplified, cloned into pQTEV vector,

sequenced and expressed in Escherichia coli BL21(DE3). Proteins were isolated

using affinity column with Ni-NTA matrix, dialyzed and purified by gel filtration.

After the his-tag was cleaved using recombinant TEV protease and again purified 6

by affinity cromatography and gel filtration. The Ser/Thr kinase domain has 33.36

kDa while Ser/Thr phosphatase 25.31 kDa. Using crystalization screening kit, the

test was carried out using various combinations of buffers and precipitants. Some

buffers had positive characteristics for the development of crystals, however an

ideal crystal for diffraction X-ray and acquisition of three-dimensional structure was

not obtained. A longer period is required for the development of a stable and ideal

crystallographic structure, beyond an improvement of the buffer components that

have obtained a satisfactory effect in the process.

7

INTRODUÇÃO

! Nos últimos anos, a crescente facilidade na obtenção e o mau uso de

quimioterápicos antibióticos tem levado ao aparecimento de diversos casos de tolerância

e resistência por parte dos microorganismos infecciosos. A busca por alvos alternativos e

o desenho racional de inibidores contra esses patógenos tem ganhado grande

importância na saúde e bem estar de humanos e animais. Um alvo ideal é aquele que

possui um inibidor eficiente que impede o funcionamento normal de uma via metabólica

essencial ao micro-organismo, consequentemente inviabilizando sua sobrevivência. Além

disso, esse alvo deve estar ausente ou modificado no hospedeiro, além da droga inibidora

possuir um nível tolerável de toxicidade (Bugg, 2004). Recentemente com advento de

novas técnicas em biologia molecular estrutural, muitas macromoléculas estão tendo suas

estruturas solucionadas, facilitando o desenho e modificação de moléculas inibidoras.

! Diversos são os mecanismos utilizados pelos seres vivos para autorregulação e

sobrevivência frente a mudanças e estímulos externos e internos, como fosforilação,

controle do fluxo de íons, liberação de sinalizadores e mensageiros, entre outros (Kraus,

2003). A fosforilação apresenta-se como um mecanismo ímpar e onipresente no controle

e sinalização celular.

1.1 Fosforilação

! A habilidade de modificar a ação de enzimas é o principal mecanismo da regulação

celular em resposta a estímulos internos e externos, direcionando a atividade de redes

metabólicas que controlam os processos fisiológicos da célula.

! A fosforilação de resíduos de hidroxiaminoácidos de proteínas é uma modificação

pós-traducional presente em praticamente todos os seres vivos conhecidos. Ligado

covalentemente às hidroxilas dos resíduos dos aminoácidos serina, treonina, tirosina,

histidina e aspartato (Johnson & Lewis, 2001), o grupo fosfato altera a estrutura nativa da

proteína, ativando-a ou inativando-a. Esse fato deve-se as propriedades especiais do

PO4, que possui um pKa de 6,7 e carrega duas cargas negativas quando em pH neutro,

isto é, ele gera duas cargas negativas na cadeia lateral do aminoácido fosforilado, como

exemplificado na Figura 1. Devido a presença desse fosfato e de quatro átomos de

8

oxigênio, ocorre forte interação através do hidrogênio de outros resíduos, permitindo que

ocorram ligações entre diferentes regiões da cadeia carbônica. Grupos duplamente

carregados com carga negativa não ocorrem em outros elementos estruturais de

proteínas. Os ésteres de fosfato de serina, treonina e tirosina são bastante estáveis a

temperatura ambiente e pH neutro; raramente hidrolisam espontaneamente. Por esse

motivo, esse processo de fosforilação reversível é catalisado por enzimas quinases que

incorporam fosfato (proveniente de uma molécula de ATP) através de sua atividade de

fosfotransferase e por enzimas fosfatases que o hidrolizam (Kraus, 2003). A Figura 2

exemplifica a ativação ou inativação de proteínas através da atividade dessas enzimas.

!

!

9

Fig. 1 - Mudança na carga de proteínas através da fosforilação. A fosforilação de resíduos de Ser (acima) e Tre (abaixo) é catalisada por quinases específicas que utilizam ATP como doador de fosfatos. O produto da reação

é uma Ser/Tre fosforilada que possui duas cargas negativas em pH neutro (Kraus, 2003).

– Tyr-specific protein kinases create a phosphate ester with the phenolic OH group of Tyr residues.

– Histidine-specific protein kinases form a phosphoro(?)us amide with the 1 or 3 position of His. The members of this enzyme family also phosphorylate Lys and Arg resi- dues.

Fig. 7.1 Amino acid specificity of protein kinases.

7 Ser/Thr-specific Protein Kinases and Protein Phosphatases270

Fig. 2 - A função de proteínas quinases e fosfatases. De acordo com a proteína alvo, sua fosforilação pode ativar ou inativar sua função. No caso de P1, a fosforilação a torna ativa, enquanto o contrário é válido para P2 (Kraus, 2003).

logous with respect to the sequence of the catalytic domain, where s PP2C appears to have a distinct evolutionary background. Generally, the protein phosphatases aremade up of a catalytic subunit with one or more associated subunits that ha e regulatory and/or targeting functions.

7.6.2 Regulation of Ser/Thr Protein Phosphatases

Protein phosphatases are the antagonists of protein kinases. They perform a dual func- tion. By diminishing and terminating a signal created by protein phosphorylation, they can have a damping effect on protein kinase-mediated signal transduction. Protein phosphatases can also have a positive, reinforcing effect in signaling pathways. Depho- sphorylation of a signal protein by a protein phosphatase can lead to its activation and thus to amplification of the signal (Fig. 7.15). Because of these functions, the protein phosphatases are an indispensable part of

signal transduction processes involving protein phosphorylation. It is therefore not surprising that the protein phosphates are subject to diverse and complex regula- tion. A large part of this regulation is exerted via additional subunits that associate with the catalytic subunit to form the active holoenzyme. These subunits serve to transmit incoming signals to the catalytic subunit and to target the catalytic subunit to distinct subcellular sites. Regulation of the Ser/Thr phosphatases takes place predominantly by the following

mechanisms:

Fig. 7.15 The dual function of protein kinases and protein phosphatases. Phosphorylation of proteins (P1, P2) can fix the latter into an active or inactive state. In the case of P1, protein kinases have an activating effect and protein phosphatases are inactivating; the reverse is true for P2.

7.6 Ser/Thr-specific Protein Phosphatases 297

! Estudos com interações proteína-proteína demonstraram que os grupos fosfato

interagem com nitrogênios presentes na cadeia principal do início de α-hélices, onde

frequentemente glicina é encontrada. Já em interações sem α-hélices, os grupos fosfatos

normalmente interagem com resíduos de arginina (Kraus, 2003).

! De acordo com a especificidade da estrutura dos aminoácidos, a fosforilação é

realizada por enzimas que fosforilam serinas e treoninas ou tirosinas, dividindo essas

enzimas em quatro grupos principais: as Ser/Tre e Tir quinases e fosfatases.

! Até recentemente, acreditava-se que a fosforilação de serinas/treoninas e tirosinas

era um evento exclusivo de eucariotos, enquanto apenas a fosforilação de histidinas e

aspartato estavam presentes em procariotos (Johnson & Lewis, 2001; Kennelly & Potts,

1996; Wolanin et. al., 2002). Entretando, com o avanço da ciência, especialmente

genômica, descobriu-se que procariotos possuem genes de proteínas quinases e

fosfatases de Ser/Tre e Tir eukaryotic-like (Shi et al, 1998), com estrutura e função

semelhante a enzimas eucarióticas, porém com sequências primárias variávies.

! 1.2 Importância Fisiológica

! As Ser/Tre quinases e fosfatases têm demostrado participar de diversos eventos

fisiológicos em procariotos, como diferenciação morfológica e metabolismo (Umeyeama

et. al., 2002), resposta a estresse oxidativo (Neu et. al., 2002), transporte de açúcares

(Deutscher & Saier, 1983), metabolismo da glicose (Nariya & Inouye, 2002, 2003),

crescimento celular (Treuner-Lange et. al., 2001), viabilidade celular (Gaidenko et. al.,

2002), esporulação (Madec et. al., 2002), entre outros.

! Proteínas quinases e fosfatases presentes em procariotos estão intimamente

relacionadas a dois sistemas fisiológicos principais: fosfoenolpiruvato (PEP) carboidrato

fosfotranferase (phosphoenolpyruvate carbohydrate phosphotranferase - PTS) e sistema

de duplo componente (two component system - TCS). Os sistemas PTSs promovem a

incorporação de fosfatos à carboidratos de superfície, permitindo a translocação e

retenção dos mesmos na membrana citoplasmática (Postma et. al., 1993).

! Já os sistemas TCSs são compostos por uma proteína receptora histidina quinase

que sinaliza para fosforilação de um regulador de resposta que controla diretamente a

expressão gênica perante estímulos ambientais (Stock et al., 2000; West & Stock, 2001).

10

A expressão de alguns fatores de virulência é em alguns casos controlada por TCSs. Em

Salmonella, por exemplo, o PhoP-PhoQ TCS é o principal regulador de fatores de

viruência (Beier & Gross, 2006). Experimentos utilizando géis bidimensionais revelaram

que um acréscimo na concentração de cátions divalentes, como cálcio e magnésio,

ativam esse sistema, controlando a expressão de mais de 40 diferentes proteínas

(Véscovi et al., 1994). Apesar da denominação, o TCSs não é composto por apenas dois

compenentes, porém o que define esse sistema é a presença do sensor histidina quinase

e seu respectivo regulador de resposta (West & Stock, 2001).

! A resistência a diversos antibióticos e fatores de defesa do hospedeiro ocorre

algumas vezes devido a presença de moléculas de lipopolissacarídeos (LPS) na

membrana externa de bactérias Gram negativas. Yethon et al. (1998) demonstraram que

as quinases WaaY e WaaP são responsáveis pela fosforilação dos LPS em Escherichia

coli. Esses exopolissacarídeos também impedem a fagocitose por macrófagos e a ação

de neutrófilos, além de inibir o sistema complemento.

! 1.3 Serina/Treonina quinases e fosfatases

! As proteínas Ser/Tre quinases possuem um domínio catalítico comum de

aproximadamemnte 280 aminoácidos, possuindo 12 subdomínios numerados de I-V, VIa,

VIb, e VII-XI (Shi et al., 1998). A conservação absoluta é rara, porém 12 resíduos estão

quase sempre presentes. A primeira fosfoproteína de procarioto caracterizada foi a

isocitrato dehidrogenase de Escheria coli, em 1979, por Garnak & Reeves (1979).

Surpreendentemente, essa enzima bifuncional (quinase/fosfatase) não exibia nenhuma

sequência similar a quinases eucarióticas. Esse fato despertou enorme interesse nos

últimos anos, visto que através do desenho de inibidores de proteínas específicas de

procariotos, seria possível o desenvolvimento de novas moléculas para antibioticoterapia.

! Outro fato interessante é o de que no genoma de bactérias Gram-negativas, os

genes das quinases e suas respectivas fosfatases encontram-se relativamente próximos e

em muitos casos um seguido do outro, favorecendo sua expressão coordenada e

consequentemente o controle sobre os substratos correspondentes (Kennelly, 2002).

Entretando, no genoma de Gram-positivas, os genes do par de enzimas estão geralmente

separadas por dois genes necessários para a atividade da quinase. Geralmente esses

11

grupos de genes fazem parte de um grande operon para coordenar a biossíntese,

processamento ou regulação de polissacarídeos extracelulares.

! 1.4 Acidothermus cellulolyticus

! Recentemente, com advento de novas técnicas em genômica e as facilidades de

manuseio de grandes volumes de informação através da bioinformática, centenas de

genomas inteiros foram sequenciados e estão disponíveis em bancos de dados virtuais.

Em 2009, Barabote et. al. sequenciaram o genoma da actinobactéria Acidothermus

cellulolyticus. Esse microorganismo Gram-positivo foi isolado em fontes hidrotermais no

parque nacional de Yellowstone, EUA (Mohaguegui et. al., 1986). A bactéria termófila, com

crescimento ótimo em cerca de 55ºC, apresentou um repertório de enzimas com possível

utilização para produção de biomassa, elevando o valor industrial desse organismo.

Foram encontrados 2217 genes codificando 2157 proteínas, em um total de 2,4Mbp.

Entre esses genes foi verificado, por homologia, a presença de várias candidatas a

quinases e fosfatases eukaryotic-like.

! O gene Acel_0019 possui 1746 pb, predizendo uma estrutura com atividade de

serina/treonina quinase com 582 aminoácidos. O domínio catalítico é composto por 262

aminoácidos (18-280), e apresenta-se destacado na sequência abaixo. As regiões

destacadas em verde indicam domínios PASTA, que são regiões transmembrana

presentes em receptores de quinases em muitas bactérias Gram-positivas, como

Mycobacterium tuberculosis. Esses receptores, classificados como PknB, são estruturas

transmembrana que possuem um domínio extracelular receptor com múltiplos domínios

PASTA e uma região intracelular que compreende um domínio com atividade de Ser/Tre

quinase. Essas regiões PASTA são encontradas na extremidade C-terminal de diversas

proteínas associáveis a penicilina (penicillin binding proteins - PBPs) e Ser/Tre quinases

de bactérias. O nome PASTA é derivado de PBS e domínio associado a Ser/Tre quinase

(Ser/Thr kinase associated domain). A proteína possui um peso molecular total de 61,434

kaDa.

! Sequência de Acel_0019 (GeneID 4484678) - proteína Ser/Thr quinase:

GTGACGAGCAACGACTCGCTGACAAACCAGCCGCGGCGCATCCTCGCCGACCGATATGAACTCGGC

GAAATCCTCGGCTACGGCGGGATGGCTGAGGTACGCCGGGGCCGTGATCTCCGCTTGGGCCGCGAC

GTTGCCATCAAGACGCTCCGTGTCGACCTCGCCCGCGACACGTCATTTCAGACACGTTTCCGCCGG 12

GAAGCGCAAGCAGCCGCCGCGCTCAATCACCCGTCGATTGTTGCTGTTTACGACACCGGTGAGAGC

ATGCTGGACGGCGTCCCGGTGCCCTATATCGTGATGGAGTACGTCGAGGGGCGGACGCTGCGGGAC

ATCCTGAAAAGCGAGTCGCACATTCTTCCCCGCCGCGCACTGGAAATCGTCGCCGACATTCTTGCC

GCACTCGAATACAGCCACCGCAACGGCATCGTGCATCGGGACATCAAGCCCGGCAACATCATGCTG

ACCCACAACGGCGAGGTCAAGGTGATGGATTTCGGCATCGCCCGCGCCGTCGCTCAATCCACGGCG

ACTGTGACCCAGACCGCCGCCGTCATCGGAACCGCGCAGTACCTCTCGCCCGAACAAGCCCGCGGC

GAGCCGGTGGACCCCCGCAGCGACATTTACTCGACCGGCTGCGTTCTCTACGAACTCCTCACCGGT

ACCCCGCCGTTCACCGGGGAATCCGCGGTAGCGGTCGCTTACCAGCACGTCCGGGAAGATCCGGTG

CCTCCGTCACGACTTAATCCCGACGTCACACCGGACATTGACGCGATCGTCATGAAGGCCTTGGCG

AAGAACCCCGCGAACCGGTACCAGAGTGCTGCGGAGATGCGAGCGGACATCGAGCGGGCGCTGCTG

GGTAAACCCGTCCAAGCAACACCGCTGCTCCTCGACCCGACGGAGCGGTTGTCCGCTGTCACGGAG

GAGATCCGCCCTGCTCAGCCCCGGACCCGGCGCGGTCTCATCTACACCCTGCTCGCGGTCGCCGTC

CTCGCCCTCCTAGTAGCACTCGGTCTACTCGCCCGCCAACTGATCACCGGTTCACACGCCACGCCG

ACGCTTCCGGTACCCAACGTGATAAACATGACCCAATCGCAAGCCGAGCAGACATTGACCAGCGAC

GGGTTCAAGGTCAAGGTCGAGACGCAGCCGAACGCTTCGGTGCCGCAGGGGATCGTCTTCGATCAA

AACCCGACCGCGGGGACACGGCTGCCGAAGAACTCGGTCGTCACAATCACGGTGTCCGCTGGGCCA

AAGACGGTGACCGTACCTGACCTGACCAACAAATCGTTGGAGGACGCCCGGGCTGCCCTTCGGGCG

CTCGGTCTCACCGTGGGGAATGTGACGCAGCGCGATTCGCAGCAACCGGCCGGCACGGTGCTCGAT

CAGAATCCGAAACCCGGCTCCCCAGCCGCCGCCGGCTCGCGCGTCGACCTTGTCGTCGCCAGCGGA

ACCGGCACCGTTCCCGATGTCCGAGGCCTGCCGACCAGCGACGCCGAACAAGAACTGACCAGCGCC

GGCTATGCCTACAACGTCGTCGAAGAACCAAGCAACGACGTCCAACAGGGATTCGTCATCAACCAA

GTGCCGGGACCTGGACGCACCGCACCGCTTGGGTCCACCGTGACGCTCTACGTGTCGTCCGGTACG

CCGTCGGCGTCGCCGTCGTCGTCGGCCTCCGCCTCACCGTCACCGAGCGGGTCGCCGTCGAGTCCA

GCGCCGTCGCCGTCGGCGAGCAGCTCACCGTAG

! Tradução:

MTSNDSLTNQPRRILADRYELGEILGYGGMAEVRRGRDLRLGRDVAIKTLRVDLARDTSFQTRFRR

EAQAAAALNHPSIVAVYDTGESMLDGVPVPYIVMEYVEGRTLRDILKSESHILPRRALEIVADILA

ALEYSHRNGIVHRDIKPGNIMLTHNGEVKVMDFGIARAVAQSTATVTQTAAVIGTAQYLSPEQARG

EPVDPRSDIYSTGCVLYELLTGTPPFTGESAVAVAYQHVREDPVPPSRLNPDVTPDIDAIVMKALA

KNPANRYQSAAEMRADIERALLGKPVQATPLLLDPTERLSAVTEEIRPAQPRTRRGLIYTLLAVAV

LALLVALGLLARQLITGSHATPTLPVPNVINMTQSQAEQTLTSDGFKVKVETQPNASVPQGIVFDQ

NPTAGTRLPKNSVVTITVSAGPKTVTVPDLTNKSLEDARAALRALGLTVGNVTQRDSQQPAGTVLD

13

QNPKPGSPAAAGSRVDLVVASGTGTVPDVRGLPTSDAEQELTSAGYAYNVVEEPSNDVQQGFVINQ

VPGPGRTAPLGSTVTLYVSSGTPSASPSSSASASPSPSGSPSSPAPSPSASSSP-Cterminal.

! Já o gene Acel_0022 possui 1263pb e codifica uma proteína com atividade de

serina/treonina fosfatase com 421 aminoácidos. Esta pertencente a família 2C, com

arquitetura e mecanismo catalítico semelhante a PP1, PP2A e PP2B, porém sem

similaridades de sequência primária. O domínio catalítico é composto por 222

aminoácidos (6-228) e apresenta-se destacado abaixo. A proteína possui um peso

molecular total de 44,353 kDa.

! Sequência de Acel_0022 (GeneID: 4484681) - Proteína Ser/Thr fosfatase:

GTGGCGTTGACGCTCCGCTACGCGGCACGTTCTGACGTCGGCCTGATTCGGGCGTCGAATCAGGAC

GCCGTGTACGCCGGGCCCCATCTGCTCGCGGTGGCCGACGGTATGGGTGGGCACGCCGCCGGGGAC

GTCGCCAGTGCGGTGGCCATTGCGAGTCTGGCGCCGCTCGACGAGGATGAGCCGCCTGCTGACATG

CTCGGTGCGCTTGACCAAGCAATTCGGCGGGCGAACGAGCATTTGCGGCTCATGACCGAAGCGGAC

AGTGAATTGGAGGGCATGGGCACCACCCTCACCGCATTGCTGTGGAACGGCAACCGGGTCGCCCTC

GCGCACATCGGCGACTCCCGCGCCTACCTGCTCCGCGACGGAGAACTCACACAAATCACCGAGGAC

CACACGCTGGTCCAGCGCCTTATCGACGAGGGTCAAATCGACGAATCCGAAGCCGCAACGCATCCA

CAGCGTTCCGTCATTCTTCGCGTGTTGACCGGCCGTCCGGACGACGTCGCCGACTTGTCCATCCGC

GAAGTCCGGGCCGGCGATCGGTTTTTACTCTGCAGCGACGGGCTTTCCGGAGTCGTCAGCAAAGAG

ACGCTGCGCGAGACGCTGAAAATACCCGATCCCGACGAAGCCGCCGACGCACTGATTCAACTGGCG

CTGCGGGCCGGAGCACCGGATAACGTGACCTGCATCGTCTGTGACGTCGTCGACGATACCGACCAA

TCGATACCGTCCGAGCCAATCATCGGCGGCTCAGTCGCCGGCCAGACGACGTCCACCAACACCGTG

TCAGACAGCGCGGCAGCCCGGGCGGCGGCCCTGCGCCCGCGGCGGCAATCGTTCGTGAAGCGGGTC

GTCGTCGACGATCAGCCTGGCCGGCGGTGGCGCGGGCCGGTCCTTGCGGTGGCGCTCATCATCGCC

GTTGCCGCCGCCCTTTTCGGCGGAACGTGGTGGTATGCCCAGCATCAGTACTATGTGGGAACCGCG

GACGGCGTCGTCGTCGTTTATCGGGGCATCAAGGGTGATGTGCTCGGCTTGGATTTCTCCTCCGTC

ATCGAGCGGACGACCATTCCCGTCGCCCAACTTCCCGCCTACCAGCGGGAGCGCGTAATGGACACG

ATCAGCGTCCCCAACCGGGCCGCAGCGGAGCGGATCGTCGAGCAGCTTCGCGCCTCGCTGCCCTCC

CCACCCGGCGCGCCGCAGAGCGCGGCACCGTCACCCACTCCACCGGCCACGGCGACGCCAGCGGCA

GGATCACCATGA

Tradução:

14

MALTLRYAARSDVGLIRASNQDAVYAGPHLLAVADGMGGHAAGDVASAVAIASLAPLDEDE

PPADMLGALDQAIRRANEHLRLMTEADSELEGMGTTLTALLWNGNRVALAHIGDSRAYLLR

DGELTQITEDHTLVQRLIDEGQIDESEAATHPQRSVILRVLTGRPDDVADLSIREVRAGDR

FLLCSDGLSGVVSKETLRETLKIPDPDEAADALIQLALRAGAPDNVTCIVCDVVDDTDQSI

PSEPIIGGSVAGQTTSTNTVSDSAAARAAALRPRRQSFVKRVVVDDQPGRRWRGPVLAVAL

IIAVAAALFGGTWWYAQHQYYVGTADGVVVVYRGIKGDVLGLDFSSVIERTTIPVAQLPAY

QRERVMDTISVPNRAAAERIVEQLRASLPSPPGAPQSAAPSPTPPATATPAAGSP-

Cterminal.

!

!

15

OBJETIVO

! A proposta do presente projeto é clonar, expressar os domínios catalíticos das

enzimas Ser/Tre quinase e Ser/Tre fosfatase de Acidothermus cellulolyticus, purificá-las e

prepará-las para a obtenção de um cristal ideal para definir a estrutura tridimensinal das

proteínas através de cristalografia de raios-X. Futuramente, a estrutura poderá ajudar na

compreensão do mecanismo de funcionamento dos domínios catalíticos além do desenho

de inibidores para essa importante classe de enzimas de procariotos.

16

MATERIAL E MÉTODOS

! 2.1 Preparação dos plasmídeos recombinantes

! O fragmento do gene da proteína Ser/Tre quinase que foi amplificado está

destacado na sequência abaixo. Essa região de 910pb corresponde ao sítio catalítico da

enzima, como mostrado na sequência traduzida. Esse peptídeo possui 304 aminoácidos

e peso molecular de 33,369kDa.

! Sequência de interesse da Ser/Tre quinase:

GTGACGAGCAACGACTCGCTGACAAACCAGCCGCGGCGCATCCTCGCCGACCGATATGAACTCGGC

GAAATCCTCGGCTACGGCGGGATGGCTGAGGTACGCCGGGGCCGTGATCTCCGCTTGGGCCGCGAC

GTTGCCATCAAGACGCTCCGTGTCGACCTCGCCCGCGACACGTCATTTCAGACACGTTTCCGCCGG

GAAGCGCAAGCAGCCGCCGCGCTCAATCACCCGTCGATTGTTGCTGTTTACGACACCGGTGAGAGC

ATGCTGGACGGCGTCCCGGTGCCCTATATCGTGATGGAGTACGTCGAGGGGCGGACGCTGCGGGAC

ATCCTGAAAAGCGAGTCGCACATTCTTCCCCGCCGCGCACTGGAAATCGTCGCCGACATTCTTGCC

GCACTCGAATACAGCCACCGCAACGGCATCGTGCATCGGGACATCAAGCCCGGCAACATCATGCTG

ACCCACAACGGCGAGGTCAAGGTGATGGATTTCGGCATCGCCCGCGCCGTCGCTCAATCCACGGCG

ACTGTGACCCAGACCGCCGCCGTCATCGGAACCGCGCAGTACCTCTCGCCCGAACAAGCCCGCGGC

GAGCCGGTGGACCCCCGCAGCGACATTTACTCGACCGGCTGCGTTCTCTACGAACTCCTCACCGGT

ACCCCGCCGTTCACCGGGGAATCCGCGGTAGCGGTCGCTTACCAGCACGTCCGGGAAGATCCGGTG

CCTCCGTCACGACTTAATCCCGACGTCACACCGGACATTGACGCGATCGTCATGAAGGCCTTGGCG

AAGAACCCCGCGAACCGGTACCAGAGTGCTGCGGAGATGCGAGCGGACATCGAGCGGGCGCTGCTG

GGTAAACCCGTCCAAGCAACACCGCTGCTCCTCGACCCGACGGAGCGGTTGTCCGCTGTCACGGAG

GAGATCCGCCCTGCTCAGCCCCGGACCCGGCGCGGTCTCATCTACACCCTGCTCGCGGTCGCCGTC

CTCGCCCTCCTAGTAGCACTCGGTCTACTCGCCCGCCAACTGATCACCGGTTCACACGCCACGCCG

ACGCTTCCGGTACCCAACGTGATAAACATGACCCAATCGCAAGCCGAGCAGACATTGACCAGCGAC

GGGTTCAAGGTCAAGGTCGAGACGCAGCCGAACGCTTCGGTGCCGCAGGGGATCGTCTTCGATCAA

AACCCGACCGCGGGGACACGGCTGCCGAAGAACTCGGTCGTCACAATCACGGTGTCCGCTGGGCCA

AAGACGGTGACCGTACCTGACCTGACCAACAAATCGTTGGAGGACGCCCGGGCTGCCCTTCGGGCG

CTCGGTCTCACCGTGGGGAATGTGACGCAGCGCGATTCGCAGCAACCGGCCGGCACGGTGCTCGAT

CAGAATCCGAAACCCGGCTCCCCAGCCGCCGCCGGCTCGCGCGTCGACCTTGTCGTCGCCAGCGGA 17

ACCGGCACCGTTCCCGATGTCCGAGGCCTGCCGACCAGCGACGCCGAACAAGAACTGACCAGCGCC

GGCTATGCCTACAACGTCGTCGAAGAACCAAGCAACGACGTCCAACAGGGATTCGTCATCAACCAA

GTGCCGGGACCTGGACGCACCGCACCGCTTGGGTCCACCGTGACGCTCTACGTGTCGTCCGGTACG

CCGTCGGCGTCGCCGTCGTCGTCGGCCTCCGCCTCACCGTCACCGAGCGGGTCGCCGTCGAGTCCA

GCGCCGTCGCCGTCGGCGAGCAGCTCACCGTAG

Tradução:

MTSNDSLTNQPRRILADRYELGEILGYGGMAEVRRGRDLRLGRDVAIKTLRVDLARDTSFQTRFRR

EAQAAAALNHPSIVAVYDTGESMLDGVPVPYIVMEYVEGRTLRDILKSESHILPRRALEIVADILA

ALEYSHRNGIVHRDIKPGNIMLTHNGEVKVMDFGIARAVAQSTATVTQTAAVIGTAQYLSPEQARG

EPVDPRSDIYSTGCVLYELLTGTPPFTGESAVAVAYQHVREDPVPPSRLNPDVTPDIDAIVMKALA

KNPANRYQSAAEMRADIERALLGKPVQATPLLLDPTERLSAVTEEIRPAQPRTRRGLIYTLLAVAV

LALLVALGLLARQLITGSHATPTLPVPNVINMTQSQAEQTLTSDGFKVKVETQPNASVPQGIVFDQ

NPTAGTRLPKNSVVTITVSAGPKTVTVPDLTNKSLEDARAALRALGLTVGNVTQRDSQQPAGTVLD

QNPKPGSPAAAGSRVDLVVASGTGTVPDVRGLPTSDAEQELTSAGYAYNVVEEPSNDVQQGFVINQ

VPGPGRTAPLGSTVTLYVSSGTPSASPSSSASASPSPSGSPSSPAPSPSASSSP -

Cterminal.

! Já o fragmento amplificado gene da proteína Ser/Tre fosfatase possui 714pb,

sendo traduzido em um peptídeo de 280 aminoácidos e peso molecular de 25,319kDa.

! Sequência do gene da enzima Ser/Tre fosfatase e sequência primária são

mostrados a seguir:

GTGGCGTTGACGCTCCGCTACGCGGCACGTTCTGACGTCGGCCTGATTCGGGCGTCGAATCAGGAC

GCCGTGTACGCCGGGCCCCATCTGCTCGCGGTGGCCGACGGTATGGGTGGGCACGCCGCCGGGGAC

GTCGCCAGTGCGGTGGCCATTGCGAGTCTGGCGCCGCTCGACGAGGATGAGCCGCCTGCTGACATG

CTCGGTGCGCTTGACCAAGCAATTCGGCGGGCGAACGAGCATTTGCGGCTCATGACCGAAGCGGAC

AGTGAATTGGAGGGCATGGGCACCACCCTCACCGCATTGCTGTGGAACGGCAACCGGGTCGCCCTC

GCGCACATCGGCGACTCCCGCGCCTACCTGCTCCGCGACGGAGAACTCACACAAATCACCGAGGAC

CACACGCTGGTCCAGCGCCTTATCGACGAGGGTCAAATCGACGAATCCGAAGCCGCAACGCATCCA

CAGCGTTCCGTCATTCTTCGCGTGTTGACCGGCCGTCCGGACGACGTCGCCGACTTGTCCATCCGC

GAAGTCCGGGCCGGCGATCGGTTTTTACTCTGCAGCGACGGGCTTTCCGGAGTCGTCAGCAAAGAG

ACGCTGCGCGAGACGCTGAAAATACCCGATCCCGACGAAGCCGCCGACGCACTGATTCAACTGGCG

CTGCGGGCCGGAGCACCGGATAACGTGACCTGCATCGTCTGTGACGTCGTCGACGATACCGACCAA

TCGATACCGTCCGAGCCAATCATCGGCGGCTCAGTCGCCGGCCAGACGACGTCCACCAACACCGTG 18

TCAGACAGCGCGGCAGCCCGGGCGGCGGCCCTGCGCCCGCGGCGGCAATCGTTCGTGAAGCGGGTC

GTCGTCGACGATCAGCCTGGCCGGCGGTGGCGCGGGCCGGTCCTTGCGGTGGCGCTCATCATCGCC

GTTGCCGCCGCCCTTTTCGGCGGAACGTGGTGGTATGCCCAGCATCAGTACTATGTGGGAACCGCG

GACGGCGTCGTCGTCGTTTATCGGGGCATCAAGGGTGATGTGCTCGGCTTGGATTTCTCCTCCGTC

ATCGAGCGGACGACCATTCCCGTCGCCCAACTTCCCGCCTACCAGCGGGAGCGCGTAATGGACACG

ATCAGCGTCCCCAACCGGGCCGCAGCGGAGCGGATCGTCGAGCAGCTTCGCGCCTCGCTGCCCTCC

CCACCCGGCGCGCCGCAGAGCGCGGCACCGTCACCCACTCCACCGGCCACGGCGACGCCAGCGGCA

GGATCACCATGA

Tradução: N-terminal -

MALTLRYAARSDVGLIRASNQDAVYAGPHLLAVADGMGGHAAGDVASAVAIASLAPLDEDE

PPADMLGALDQAIRRANEHLRLMTEADSELEGMGTTLTALLWNGNRVALAHIGDSRAYLLR

DGELTQITEDHTLVQRLIDEGQIDESEAATHPQRSVILRVLTGRPDDVADLSIREVRAGDR

FLLCSDGLSGVVSKETLRETLKIPDPDEAADALIQLALRAGAPDNVTCIVCDVVDDTDQSI

PSEPIIGGSVAGQTTSTNTVSDSAAARAAALRPRRQSFVKRVVVDDQPGRRWRGPVLAVAL

IIAVAAALFGGTWWYAQHQYYVGTADGVVVVYRGIKGDVLGLDFSSVIERTTIPVAQLPAY

QRERVMDTISVPNRAAAERIVEQLRASLPSPPGAPQSAAPSPTPPATATPAAGSP - C-

terminal.

! Os genes da Ser/Tre quinase e fosfatase foram amplificados do DNAg de A.

cellulolyticus (ATCC®), utilizando os primers descritos na Tabela 1. Para a reação, utilizou-

se 1µl de DNAg, 5 pM de cada primer, 10mM dNTP, 1mM de SO4Mg e 2,5U da enzima

Pfx (Invitrogen) com seu respectivo tampão e H20 miliQ estéril q.s.p. 100 µl. O programa

de amplificação foi: 94º por 5 minutos, 94º por 30 segundos, anelamento de 55º por 30

minutos, extensão de 68º por 1,5 minutos, com extensão final de 7 minutos após 35

ciclos.

! Os produtos das reações foram verificados em gel de agarose 1% e purificados

utilizando o Qiagen PCR Purification Kit®(Qiagen). Após, realizou-se a restrição dos

fragmentos com suas respectivas enzimas de acordo com as instruções do fabricante.

Para a quinase e fosfatase as condições foram idênticas: 30µl de produto da PCR

purificada, 15U da HindIII (Fermentas), 15U de BamHI (Fermentas), Buffer Red 10X e

19

volume final ajustado para 40µl, incubado a 37ºC por 2 horas.

! O vetor de expressão pQTEV (Entelechon), GenBank AY243506, foi restringido

utilizando as enzimas HindIII e BamHI e defosforilado usando SAP (shrimp alcaline

phosphatase). Para a clonagem do inserto foram utilizados 3,6µl de produto da PCR

clivado e purificado, 0,4µl de vetor e 3U de T4-ligase (Promega) com seu respectivo

tampão. O vetor pQTEV agrega uma sequência de 7 histidinas na porção N-terminal, que

posteriormente será utilizada na purificação por afinidade, além de um sítio de clivagem

utilizado pela protease TEV (tobacco etch virus). No total são 24 aminoácidos N-terminais

adicionados, adicionando 2,982kDa ao peso molecular. O mapa do vetor está sendo

mostrado na Figura 3.

!

20

Fig. 3 - Vetor pQTEV (Entelechon). A cauda de histidina N-terminal (his-tag), o sítio de clivagem com protease TEV e os sítios de restrição são mostrados na sequência abaixo.

! 2.2 Transformação e Sequenciamento

! O plasmídeo recombinante foi transformado em bactérias Escherichia coli TOP10

competentes quimicamente com cloreto de cálcio, através da alternância de temperaturas.

As mesmas foram plaqueadas em meio LB-agar e ampicilina. Foram selecionadas 5

colônias de cada gene e inoculadas em meio LB (Luria-Bertani) a 37ºC sob agitação. A

extração dos plasmídeos foram realizadas utilizando Qiagen Miniprep Kit® (Qiagen).

! As minipreps foram submetidas a restrição nas condições descritas anteriormente

e aquelas que demonstraram a inserção do clone foram enviadas ao sequenciamento. O

sequenciamento foi realizado utilizando o primer pQTEV_for (5ʼ gaaattaactatgaaacatca

ccatc 3ʼ) em aparelho Hitachi 3130xl Genetic Analyzer (Applied Biosystem) e os

resultados analisados com o programa Chromas Lite v. 2.01 (Technelysium).

Tabela 1 - Primers contendo sítios de restrição para amplificação de Acel_0019 e Acel_0022.

Primer Sequência Enzima de restrição

Acel_0019short_3h 5ʼ ggccggaagcttttaccggggctgagcagggcgg 3ʼ Hind III

Acel_0019short_5b 5ʼ ggccggggatccatcctcgccgaccgatatg 3ʼ Bam HI

Acel_0022short_3h 5ʼ ggccggaagcttagtcgacgacgtcacagac 3ʼ Hind III

Acel_0022short_5b 5ʼ ggccggggatccgtggcgttgacgctccg 3ʼ Bam HI

! 2.3 Teste de expressão e Expressão em grande escala

! As minipreps com sequência correta, verificada através da ferramenta BLAST -

Basic Local Alignment Search Tool (NCBI), foram transformadas em Escherichia coli BL21

(DE3)e plaqueadas em LB-ágar e ampicilina. Uma colônia selecionada foi colocada em

meio LB líquido contendo 50 µg/ml de ampicilina e crescida overnight a 37ºC sob

agitação. A partir desse pré-inóculo, iniciou-se o teste de expressão. Para isso, as

bactérias foram inoculadas em frascos com LB e 50 µg/ml ampicilina e após a densidade

óptica chegar a 0,5 iniciou-se a indução com 0,5mM de IPTG (Isopropil β-1-

tiogalactopiranosídeo), onde as mesmas foram incubadas a diferentes temperaturas: 37ºC

e 30ºC. As coletas foram realizadas a 0H (não induzida), 2H, 4H, 6H e overnight e 21

centrifugadas a 4ºC. As amostras foram lisadas com o tampão descrito na seção 2.4 e

purificadas na bancada utilizando Ni-NTA Superflow (Qiagen). As frações solúveis e

pellets foram aplicadas em SDS-PAGE 15% e coradas com Coomassie Briliant Blue.

! Após o teste de expressão, verificou-se que a temperatura de 37ºC por 4 horas era

a que demonstava maior nível de expressão da Ser/Tre quinase, enquanto que para Ser/

Tre fosfatase era 37ºC por 6 horas. Realizou-se uma expressão em larga escala em

quatro litros de meio LB com antibiótico e indução com 0,5mM de IPTG. O meio contendo

bactérias foi centrifugado a 4º e o pellet armazenado a -20ºC.

! 2.4 Lise celular

! A lise das células foi realizada ressuspendendo o pellet de bactérias em um

tampão contendo 50mM Tris-HCl pH 7,5, 100mM NaCl, 1mM PMSF (fenil metil sulfenil

fluoreto), 0,3µl de ß-mercaptoetanol, 1% Brigg, 250µg de lisozima e 50µl de DNase, e

incubando por cerca de uma hora sob agitação em gelo. Após, a lise foi maximizada

utilizando fracionamento no aparelho French Pressure® Cell Press (Thermo Spectronic),

com pressão entre 700-1000 psi.

! O lisado fracionado foi centrifugado por 1 hora a 14.000rpm e 4ºC e o

sobrenadante purificado por coluna de afinidade.

! 2.5 Purificação e diálise

! Inicialmente foi realizada uma purificação em coluna de afinidade com a resina Ni-

NTA Superflow - nickel nitrilotriacetic acid (Qiagen) através do AKTA® FPLC (fast protein

liquid cromatography - GE Healthcare). O tampão de eluição (Tampão A) continha 50mM

Tris-HCl pH 7,5, 100mM NaCl, 1mM de PMSF e 10mM de ß-mercaptoetanol. Um tampão

B contendo 0,5M de imidazol foi utilizado a 1% (5mM) durante a injeção da amostra e em

um gradiente de 40% (200mM) em 40 minutos, para eluição de ambas proteínas. O flow

throught e as frações correspondentes a um pico de absorbância (mAU - mili arbitary

units) significativo foram coletadas, unidas e dosadas utilizando o reagente de Bradford.

Um SDS-PAGE (sodium dodecyl sulfate - polyacrylamide gel electrophoresis) corado com

Comassie Brilliant Blue confirmou as massas das proteínas purificadas.

22

! As frações identificadas como a proteína recombinante foram dialisadas overnight

em membrana Spectra/Por® MWCO 14.000Da (Spectrum) em tampão contendo 25mM

Tris-HCl 7,5 e 3mM de ditiotreitol (DTT).

! A proteína foi concentrada utilizando filtros Amicon® Ultra (Milipore) de 10.000Da

para ambas as proteínas. Após, foram submetidas a gel filtração em coluna Sephadex

XK16 (GE Healthcare) em FPLC utilizando o mesmo tampão de diálise. As proteínas

foram concentradas como anteriormente descrito, resfriadas em nitrogênio líquido e

armazenadas a -80ºC.

! 2.6 Clivagem e finalização

! Inicialmente foi realizado um teste de clivagem da cauda de histidina da Ser/Tre

quinase utilizando protease TEV recombinante. Utilizou-se 1mg de TEV para cada 10mg

de amostra (1:10). O tampão 10X para a TEV contém 500mM de Tris-HCl pH8,0, 50mM

EDTA (ácido etilenodiamino tetra-acético) e 10mM DTT. A reação foi conduzida a 30ºC por

2, 4 e 6 horas, e a 4ºC overnight. O resultado foi verificado através de SDS-PAGE corado

com Coomassie Brilliant Blue.

! Após validação do teste, foi realizada a clivagem de uma alíquota de Ser/Tre

quinase a 37ºC por 6 horas nas mesmas condições de reação descritas anteriormente.

! A amostra clivada foi submetida a purificação por afinidade em coluna Ni-NTA

Superflow (Qiagen) em FPLC. Foi utilizado o tampão de diálise para eluição e Tampão B

para o gradiente de imidazol. O flow throught, que neste caso corresponde a proteína de

interesse, foi coletado, concentrado, dosado e verificado com SDS-PAGE corado com

Coomassie Brilliant Blue. A amostra foi concentrada, purificada por gel filtração,

novamente concentrada e armazenada a -80ºC, da mesma forma como descrito

anteriormente.

!

! 2.7 Screenning manual

! Foram utilizadas placas de acrílico de 24 poços e lamínulas siliconizadas para a

cristalização pela técnica de gota suspensa ou vapor difusão. O kit Crystal Screen

HR2-110 e Crystal Screen HR2-112 (Hampton Research) foram utlizados para a Ser/Tre

quinase com cauda de histidina clivada e não clivada, totalizando 96 diferentes condições 23

de tampão e precipitante. As formulações dos tampões estão descritas no Anexo 1 e

Anexo 2. Cada poço foi preenchido com 500µl de tampão e 1µl foi misturado a 1µl de

amostra da proteína purificada. As placas foram mantidas em repouso a 18ºC.

! Já o screening da Ser/Tre fosfatase foi montada com o kit Crystal Screening

HR2-110 (Hampton Research), totalizando 48 condições.

! A cada 2 dias as placas foram observadas em estereomicroscópio.

24

RESULTADOS

! 3.1 Clonagem dos genes

! Os genes da Ser/Tre quinase e Ser/Tre fosfatase foram amplificados e

apresentaram aproximadamente 900pb e 714pb, respectivamente, como pode ser

visualizado na Figura 4.

! As sequências obtidas foram comparadas utilizando BLAST. O gene da Ser/Tre

quinase clonado em pQTEV apresentou 99% de homologia com o gene Acel_0019

depositado no banco de dados NCBI:

25

!

! A sequência do gene da ser/Tre fosfatase a demonstrou 99% de homologia com o

gene Acel_0022, com apenas 3 bases mutadas.

26

Fig. 4 - Amplificação dos genes de Ser/Tre quinase e Ser/Tre fosfatase. M: marcador.

M

Ac el

_0 01

9

Ac el

_0 02

2

pb

10000

1500

1000 750 500

! 3.2 Teste de expressão

! O teste de expressão dos plasmídeos recombinantes com os genes da Ser/Tre

quinase e Ser/Tre fosfatase de A. cellulolyticus demonstrou a combinação de condições

em que as proteínas apresentaram maior nível de expressão. A Figura 5 mostra a fração

purificada com Ni-NTA Superflow (Qiagen) e os pellets obtidos para a Ser/Tre quinase,

enquanto a Figura 6 mostra os resultados do teste de expressão da Ser/Tre fosfatase.

!

27

M 0H -

N I

2H -

30 ºC

4H -

30 ºC

2H -

37 ºC

4H -

37 ºC

O N

- 30

ºC

6H -

37 ºC

O N

- 37

ºC

6H -

30 ºC

kDa

116,0

66,2

45

35

25

18,4

M 0H -

N I

2H -

30 ºC

4H -

30 ºC

6H -

30 ºC

O N

- 30

ºC

4H -

37 ºC

6H -

37 ºC

O N

- 37

ºC

2H -

37 ºC

kDa

116,0

66,2

45

35

25

18,4

Fig. 5 - SDS-PAGE 15% do teste de expressão de Ser/Tre quinase. Acima a fração solúvel purificada com Ni-NTA Superflow (Qiagen) a abaixo a fração insolúvel. M: marcador (Fermentas); NI: não induzido; ON: overnight.

! 3.3 Purificação em coluna de afinidade

! Após o teste de expressão, foi realizada expressão em grande escala das

proteínas. A purificação na coluna de Ni-NTA Superflow (Qiagen) da proteína Ser/Tre

quinase mostrou um gráfico clássico, com um pico durante a injeção, correspondente ao

flow through, de cerca de 3400 mAU e um pico correspondente a proteína de interesse de

cerca de 1500mAU após início do gradiente de imidazol. A eluição da Ser/Tre quinase

iniciou-se com 7% de Tampão B (35mM de imidazol). A Figura 6 mostra o gráfico de 28

kDa

116,0

66,2

45

35

25 18,4

M 0H -

N I

2H -

30 ºC

4H -

30 ºC

6H -

30 ºC

O N

- 30

ºC

4H -

37 ºC

6H -

37 ºC

O N

- 37

ºC

2H -

37 ºC

kDa

116,0

66,2

45

35

25

18,4

M 0H -

N I

2H -

30 ºC

4H -

30 ºC

6H -

30 ºC

O N

- 30

ºC

4H -

37 ºC

6H -

37 ºC

O N

- 37

ºC

2H -

37 ºC

Fig. 6 - SDS-PAGE 15% do teste de expressão de Ser/Tre fosfatase. Acima a fração solúvel purificada com Ni- NTA Superflow (Qiagen) a abaixo a fração insolúvel. M: marcador (Fermentas); NI: não induzido; ON: overnight.

purificação da mesma. As frações 2 a 16 foram coletadas e verificadas através de SDS-

PAGE, mostrado também na Figura 7.

! O mesmo foi observado no gráfico da purificação por afinidade da

Ser/Tre fosfatase. A eluição também ocorreu no momento que a concentração de Tampão

B era de 7% (35mM de imidazol). O gráfico e gel correspondentes estão sendo mostrados

na Figura 8.

29

kDa

116,0 66,2

45

35

25

18,4

14,4

M FT F4 F5 F6 F7 F8 F9 F1 0

Fig. 7 - Purificação por afinidade da proteína Ser/Tre quinase. Em azul mAU, em verde o gradiente de Tampão B. Abaixo um SDS-PAGE 15% das frações purificadas. M: maracador (Fermentas); FT: flow through; F: fração.

!

! 3.4 Gel filtração

! Após a diálise das amostras purificadas por afinidade, ambas foram submetidas a

concentração até um volume de 1,0 a 1,5 ml para utilização na gel filtração. O gráfico

apresentado na Figura 9 mostra a filtração da Ser/Tre quinase, enquanto a Figura 10 30

kDa

116,0 66,2

45

35

25

18,4

14,4

M FT Pi co

1

Pi co

2

Fig. 8 - Purificação por afinidade da proteína Ser/Tre fosfatase. Em azul mAU, em verde o gradiente de Tampão B. Abaixo um SDS-PAGE 15% das frações purificadas, onde as frações dos picos correspondentes foram

unidas. M: maracador (Fermentas); FT: flow through.

exibe o perfil da filtração da Ser/Tre fosfatase. Ambas filtrações mostraram um perfil

semelhante, demonstrando que a purificação por afinidade foi eficiente.

! As amostras eluídas foram concentradas em alíquotas de 6mg/ml e 20mg/ml.

31

Fig. 10 - Gel filtração da Ser/Tre fosfatase. O segundo pico (900 mAU) entre as frações 14-24 corresponde à proteína de interesse.

Fig. 9 - Gel filtração da Ser/Tre quinase. O pico principal (600mAU) entre as frações 24-28 corresponde a proteína de interesse.

! 3.5 Clivagem

! A clivagem da cauda de histidina da Ser/Tre quinase recombinante foi eficiente a

uma temperatura de 30ºC por 6 horas. Após a clivagem, foi realizada a purificação

utilizando Ni-NTA Superflow (QIAGEN) como descrito anteriormente, exceto pelo fato de o

flow through coletado corresponder a proteína sem cauda de histidina. O gráfico e SDS-

PAGE 12,5% mostrados na Figura 11 correspondem a clivagem da Ser/Tre quinase. As

bandas de menor peso obtidas com a purificação por afinidade são visíveis, e as frações

após o gradiente com Tampão B corresponderiam a TEV e proteína não clivada. A Figura

12 mostra o gráfico da gel filtração das frações clivadas.

32

Fig 11. - A proteína Ser/Tre fosfatase foi clivada com a protease TEV. O gráfico demonstra o perfil de purificação, onde o flow through corresponde à proteína clivada. A cauda de histidina pode ser visualisada através do SDS-PAGE 12,5%. A proteína visivelmente teve sua massa diminuída (F8-10) comparado ao controle positivo (C) e as frações eluídas após

gradiente de imidazol. M: marcador.

CkDa

116,0

66,2

45

35

25

18,4

14.4

M F8 F9 F1 0

F2 6

F2 7

! 3.6 Cristalização

! A cristalização das proteínas recombinantes foi realizada através do método de

screening manual em gota suspensa. Em diversas condições houve precipitação,

enquanto outros permaneceram não precipitadas. Não ouve formação de microcristais ou

cristais nas condições avaliadas.

! O tempo em que as amostras estavam em processo de cristalização no momento

da validação dos resultados foi de apenas três semanas.

33

Fig. 12 - Gel filtração da Ser/Tre quinase. O pico de cerca de 550 mAU corresponde a proteína clivada e pura, pronta para ser crsitalizada.

DISCUSSÃO

! Um dos grandes agravantes da expressão de proteínas recombinantes de

eucariotos em Escherichia coli é em relação a questão dos códons incompatíveis com o

sistema de tradução bacteriano necessário para tradução dessas estruturas. Além disso,

modificações pós-traducionais necessárias para estabilização da estrutura e função

geralmente estão ausentes nesses organismos mais simples. Por essa razão, a

expressão de genes de procariotos tende a ser menos complexa.

! Com o recente sequenciamento do genoma de A. cellulolyticus, verificou-se que

esse organismo termófilo possui vários genes com ORFs para proteínas com função de

modulação de fosfato: as quinases e fosfatases. Com domínios catalíticos não homólogos

a domínios de enzimas de eucariotos, especialmente mamíferos, a solução dessas

estruturas ajudaria no conhecimento da conformação e mecanismo de funcionamento

dessa classe de enzimas descobertas a pouco nesses organismos. Através da ferramenta

BLAST (NCBI), pode-se verificar que há pouca similariedade com proteínas de eucariotos,

enquanto seu domínio catalítico apresenta-se relativamente conservado em procariotos.

Em Mycobacterium avium, por exemplo, o gene Mav_0022 (CP000479) possui 74% de homologia com o gene da Ser/Tre fosfatase de A. cellulolyticus.

! Os domínios protéicos citoplasmáticos expressos em sistema recombinante

procarioto geralmente tendem a ficar solúvel em solução aquosa, da mesma forma como

encontrado na célula nativa. Entretanto gene da Ser/Tre quinase apresenta domínios

PASTA na porção C-terminal que estão imersos na membrana desse organismo,

permitindo a que a proteína funcione como um receptor. Por esse motivo, apenas o sítio

citoplasmático que corresponde a um domínio com atividade de quinase foi o fragmento

clonado e expresso neste trabalho, visto que é a porção funcional de interesse e por ser

de localização citoplasmática. Já a Ser/Tre fosfatase é inteiramente citoplasmática e

apenas seu domínio catalítico presente na região N-terminal foi clonado e expressado.

! O vetor de expressão utilizado, pQTEV, possui um promotor T5, um operador do

operon lac e vários sítos de restrição únicos. Através da indução da expressão, neste

34

caso IPTG, ocorre ativação da trancrição desse gene e do inserto justaposto que foi

clonado. Além disso, codifica um gene de beta-lactamase que confere resistência ao

antibiótico ampicilina e o repressor lac1 do operador do operon lac.

! Unido a extremidade N-terminal da estrutura protéica recombinante, uma porção de

24 aminoácidos (2,982 kDa) possui uma cauda de 7 histidinas e um sítio de clivagem para

protease TEV. A histidina possui um anel de imidazol em sua estrutura, onde o nitrogênio

possui a capacidade de interagir com metais ionizados tais como Zn2+, Cu2+ ou Ni2+,

permitindo a purificação através de uma coluna contendo Ni-NTA por exemplo. O níquel

por sua vez é capaz de interagir com até 6 diferentes sítios ao mesmo tempo; 4 deles

estão quelados ao ácido nitrilotriacético ligado a uma resina Sepharose® inerte, enquanto

2 ficam livres para interagir com o anel de imidazol da histidina. A Figura 11 esquematiza

a interação entre uma cauda de histidina com matriz de Ni-NTA.

! Durante a expressão existem diversas variáveis que podem influenciar o nível de

expressão no citoplasma, os principais são: temperatura de indução, o nível de indução e

natureza da proteína recombinante. A temperatura de indução ideal geralmente tende a

ser 30ºC ou menos, diminuindo o nível de expressão desfavorecendo a formação de

agregados, corpos de inclusão e renovelamento errôneo (Higgins & Hames, 1999).

Entretanto, pelo fato da bactéria A. cellulolyticus ser um organismo termófilo, com

crescimento ótimo em 55ºC, os peptídeos apresentaram um maior nível de expressão a

37ºC. Quanto ao nível de indução, quando este é bastante elevado tende a formar corpos

de inclusão e agregação citoplasmática, o que não foi observado com a Ser/Tre quinase e

35

The QIAexpressionist 06/2003 19

The Q IAexpress System

Nitrilotriacetic acid (NTA), exclusively available from QIAGEN, is a tetradentate chelating adsorbent developed at Hoffmann-La Roche that overcomes these problems. NTA (Figure 4) occupies four of the six ligand binding sites in the coordination sphere of the nickel ion, leaving two sites free to interact with the 6xHis tag (Figure 5). NTA binds metal ions far more stably than other available chelating resins (Hochuli 1989) and retains the ions under a wide variety of conditions, especially under stringent wash conditions. The unique, patented NTA matrices can therefore bind 6xHis-tagged proteins more tightly than IDA matrices, all wing the purification of proteins from less than 1% of the total protein preparation to more than 95% homogeneity in just one step (Janknecht et al. 1991).

Figure 5. Interaction between neighboring residues in the 6xHis tag and Ni-NTA matrix.

Additional information on the interaction of 6xHis-tagged proteins with Ni-NTA matrices can be found in the section “Purification” beginning on page 63.

Ni-NTA chromatographic materials QIAGEN supplies the following Ni-NTA matrices for the purification of 6xHis-tagged proteins:

Ni-NTA Agarose Ni-NTA Agarose is composed of Ni-NTA coupled to Sepharose® CL-6B and offers high binding capacity and minimal nonspecific binding. This material has excellent handling properties for batch, column, and low-pressure FPLC®. The high surface concentration of the NTA ligand is sufficient for the binding of approximately 5–10 mg of 6xHis-tagged protein per milliliter of resin. Ni-NTA Agarose is very stable and easy to handle.

!"#

!" !"#

$" !"#

!"# !"#

!"# !"

%"

%

$

!"#! %

%

%

$

$ % !

%

!"#

! %

$

$ !"#

!"#!"

!"

!

$"

%

$"

!

$"

%

&

&

$' #(

Fig. 11 - Interação entre resíduos d histidina com a matriz Ni-NTA.

fosfatase. Como ambas estruturas são domínios citoplasmáticos, também não foi

obervada fração insolúvel no SDS-PAGE do pellet, ou seja, não ocorreu precipitação.

! A purificação por afinidade realizada com a matriz Ni-NTA Superflow (Qiagen) foi

eficiente para ambas as proteínas. O PMSF é um conhecido inibidor de serinoproteases,

ligando-se ao sítio da enzima impossibilitando sua atuação, sendo importante na

composição do Tampão A. Outra estratégia para evitar a degradação da amostra é a

utilização de soluções refrigeradas, diminuindo a ação de possíveis proteases. O ß-

mercaptoetanol em baixa concentração foi necessário para clivar as pontes dissulfeto

entre proteínas impedindo a formação de interações intramoleculares e intermoleculares.

! Um gradiente de imizadol de 1% foi mantido durante a injeção do lisado na coluna

de afinidade. Na concentração de 5mM ele impede a ligação de histidina de proteínas

inespecíficas à matriz da coluna, enquanto no gradiante que chega até 40% de Tampão B

a concentração varia até 200mM, quando as proteínas com cauda de histidina geralmente

já foram eluídas.

! Mesmo com a utilização de moléculas que evitem a ligação de proteínas

inspecíficas a matriz, alguns resíduos ainda permanecem na amostra purificada. A diálise

permite a retirada de sais e pequenos peptídeos (menores que 10kDa) através dos poros

da membrana em uma solução padrão com DTT. O DTT, da mesma forma que o ß-

mercaptoetanol, funciona como um agente redutor que impede a formação de pontes

dissulfeto. Acredita-se que devido ao redox citoplasmático estas feralmente não se

formam.

! A gel filtração é outra forma de purificar a amostra possibilitando a eliminação de

peptídeos que não foram eliminados durante a diálise. Uma coluna contendo matriz de

Sepharose® possui beads sem carga de diversos tamanhos e com depressões e canais

em sua superfície. Esses pequenos canais permitem a captação de pequenos peptídos,

enquanto massas maiores, permanecem entre os beads e são eluídos mais rapidamente.

Através dessa separação por peso molecular, a amostra torna-se ainda mais pura,

possibilitando a separação de formas oligoméricas e favorecendo a formação de um

cristal.

! O precesso de crisitalização é o ponto crítico no trabalho de solução de estruturas

através de cristalografia de raio-X. A formação de um agregado ordenado se dá por duas

fases distintas: a nucleação, que corresponde a fase de formação de agregados, e o 36

crescimento, onde as proteínas em suspensão tendem a “preferir” a fase sólida à ficar em

suspensão. Para que isso ocorra, a gota contendo deve conter uma supersaturação da

amostra purificada (>95%) a pelo menos 10 mg/ml. São vários fatores que favorecem ou

dificultam a crsitalização, como pureza da amostra, contaminantes, temperatura, natureza

do peptídeo, entre outros.

! A natureza do peptídeo é o principal desses fatores. Certas proteínas cristalizam

rapidamente, enquanto outros demoram a formar agregados organizados e crescerem. A

cauda de histidina, tanto na porção N-terminal quanto C-teminal, pode dificultar esse

processo de agregação.

! A ausência de sais e agentes redutores na amostra a ser cristalizada é um pré-

requisito para uma cristalização eficiente. Quando presentes, podem dar origem a

precipitados, géis ou mesmo cristais de sais. Para eliminar esses contaminantes, a diálise

é o método mais eficiente, pois esses íons são retirados da amostra através de

membranas com microporos, sem que ocorra perda de amostra.

! Os tampões de cristalização dos kits de screening manual utilizados são formados

através da combinação de um tampão, um precipitante e um sal (mostrados no Anexo 1 e

Anexo 2). As principais combinações eficientes na cristalização de proteínas foi

combinada nesse produto, sendo útil para uma tentativa em uma ampla escala de

variações. Mesmo a formação de microcristais é importante, pois através do refinamento

dessas condições a formação de um cristal ideal pode ser maximizada.

! Com esses inúmeros fatores, a cristalização de macromoléculas em geral, tende a

ser um método empírico, onde o tempo é decisivo. A solução de estruturas através da

cristalização de raio-X é uma técnica promissora e de ampla utilizade, pois permite

conhecer detalhes não observáveis por outras técnicas, possibilitando análises evolutivas,

desenho de inibidores, determinação do mecanismo de funcionamento, interações

intermoleculares, entre outros.

37

CONCLUSÃO

! A fosforilação de serinas e treoninas parece ser um mecanismo de controle de

atividade de enzimas presente na maioria dos seres vivos. As enzimas quinases e

fosfatases moduladoras de fosfato estão presentes também em organismos procariotos.

O domínio catalîtico dessas proteínas de procariotos, como verificado em A. cellulolyticus

e outros micro-organismos, apresenta poucas similaridades com enzimas com mesma

atividade em eucariotos. Na tentativa de obter um cristal para solução da estrutura de

uma Ser/Tre quinase e fosfatase, os genes foram amplificados, clonados e expressos em

sistema procarioto. Os peptídeos obtidos foram purificados por coluna de afinidade e gel

filtração, além da diálise e clivagem da cauda de histidina.

! Através de mais de 90 diferentes combinações de tampões de cristalização, foi

montado screening manual para obtenção de um cristal. No curto período de avaliação

não foram obervados agregados organizados. Além disso será necessário um refinamento

das condições que demonstrarem favoráveis. Posteriormente, através da solução da

estrutura dessas enzimas, será possível conhecer o exato mecanismo de ação e

possibilitar o desenho de inibidores específicos.

38

REFERÊNCIAS BIBLIOGRÁFICAS

BARABOTE, R. D.; XIE, G.; LEU,D. L.; NORMAND, P.; NECSULEA, A.; DAUBIN, V.; MEʼDIGUE, C.; ADNEY, W. S.; XU, X. C.; LAPIDUS, A.; PARALES, R. E.; DETTER,C.; PUJIC, P.; BRUCE, D.; LAVIRE, C.; CHALLACOMBE, J. F.; BRETTIN, T. S.; BERRY, A. B. Complete genome of the cellulolytic thermophile Acidothermus cellulolyticus 11B provides insights into its ecophysiological and evolutionary adaptations. Gen. Res. v.19. p.1033-1043. 2009.

BEIER, D.; GROSS, R. Regulation of bacterial virulence by two componet systems. Curr. Opin. Microbiol. v. 9. p.143-152. 2006.

BUGG, T. Introduction to enzyme and coenzyme chemistry. 2d. ed. Blackwell Science: UK. 303p. 2004.

DEUTSCHER, J., SAIER, M.H., Jr. ATP-dependent protein kinase catalyzed phosphorylation of a seryl residue in HPr, a phosphate carrier protein of the phosphotransferase system in Streptococcus pyogenes. Proc. Natl. Acad. Sci. USA. v.80. p.6790–6794. 1983.

GAIDENKO, T.A., KIM, T.J., PRICE, C.W. The PrpC serine-threonine phosphatase and PrkC kinase have opposing physiological roles instationaryphase Bacillus subtilis cells. J Bacteriol. v.184. p.6109–6114. 2002.

GARNAK, M.; REEVES, H. C. Phosphorylation of isocitrate dehydrogenase of Escherichia coli. Science. v. 203. p.1111-1112. 1979.

HIGGINS, S. J.; HAMES, B. D. Protein Expression A practical Approach. Prokaryotic in vivo expression systems. PAS: Oxford. p. 169-200. 1999.

JOHNSON, L. N.; LEWIS, R. J. Structural basis for control by phosphorylation. Chem. Rev. v.101. n.08. p2209-2242. 2001. KENNELLY, P. J. Archaeal protein kinases and proteins phosphatases: insights from genomics and biochemestry. Biochem. v. 370. p373-389. 1996.

KENNELLY, P. J. Protein kinases and protein phosphatases in prokaryotes: a genomic perspective. FEMS Microbiol. v.206. p.1-8. 2002.

KRAUS, G. Biochemistry of Signal Tranduction and Regulation. 3d ed. Wiley-VCH: Germany. 544p. 2003.

MADEC, E., LASZKIEWICZ, A., IWANICKI, A., OBU- CHOWSKI, M., SEROR, S. Characterization of a membrane-linked Ser/Thr protein kinase in Bacillus subtilis, implicated in developmental processes. Mol. Microbiol. v.46. p.571–586. 2002.

MMOHAGHEGHI, A.; GROHMANN K.; HIMMEL, M.; LEIGHTON, L.; UPDEGRAFF, D. M. Isolation and characterization of Acidothermuscellulolyticus gen. nov., sp. nov., a new genus of thermophilic, acidophilic, cellulolytic bacteria. Int. J. Syst. Bacteriol. v.36. p.435-443. 1986.

39

NARIYA, H., INOUYE, S. An effective sporulation of Myxococcus xanthus requires glycogen consumption via Pkn4-activated 6-phosphofructokinase. Mol. Microbiol. v.49. p.517–528. 2003. NEU, J.M., MACMILLAN, S.V., NODWELL, J.R., Wright, G.D. StoPK-1, a serine/threonine protein kinase from the glycopeptide antibiotic producer Streptomyces toyocaensis NRRL 15009, affects oxidative stress response. Mol. Microbiol. v.44. p.417–430. 2002.

POSTMA, P. W.; LENGELER, J. W.; JACOBSON, G. R. Phosphoenolpyruvate: carbohydrate phosphotranferase systems of bacteria. Microbiol. Rev. v.57. p.543-594. 1993.

SHI, L.; POTTS, M.; KENNELLY, P. J. The seryne, threonin, and/or tyrosin-specific protein kinases and protein phosphatases of prokaryotic organisms: a family portrait. FEMS Microbiol. Rev. v.22. p.229-253. 1998

STOCK, A. M.; ROBINSON, V. L.; GOUDREAU, P. N. Two component signal transduction. Annu. Rev. Biochem. v.69. p183-215. 2000.

TREUNER-LANGE, A., WARD, M.J., ZUSMAN, D.R. Pph1 from Myxococcus xanthus is a protein phosphatase involved in vegetative growth and development. Mol. Microbiol. v.40. p.126– 140. 2001.

UMEYAMA, T., LEE, P.C., HORINOUCHI, S. Protein serine/threonine kinases in signal transduction for secondary metabolism and morphogenesis in Streptomyces. Appl. Microbiol Biotechnol. v.59. p.419–425. 2002.

VÉSCOVI, E.G.; SONCINI, F. C.; GROISMAN, E. A. The role of the PhoP-PhoQ regulon in Salmonella virulence. Res. Microbiol. v.145. p.473-480. 1994.

WEST" , A. H.; STOCK, A. M. Histidine kinases and response regulator proteins in two component signaling systems. Trends Biochem. Sci. v.26. p369-376. 2001.

YETHON, J.A.; HEINRICHS, D. E.; MONTEIRO, M. A.; PERY, M. B.; WHITFIELD, C. Involvement of WaaY and WaaQ in the modification of Escherichia coli lipopolyssacharide and their role in the formation of stable outer membrane. J. Biol. Chem. v. 273. p.26310-26316. 1998.

WOLANIN, P. M.; THOMASON, P. A.; STOCK, J.B. Histidine protein kinases: key signal tranducers outside the animal kingdom. Genome Biol. v.3. p3013.1-3013.2. 2002.

40

ANEXO 1

41

42

ANEXO 2

43

Até o momento nenhum comentário
Esta é apenas uma pré-visualização
3 mostrados em 43 páginas