














Study with the several resources on Docsity
Earn points by helping other students or get them with a premium plan
Prepare for your exams
Study with the several resources on Docsity
Earn points to download
Earn points by helping other students or get them with a premium plan
An overview of multiple sequence alignment (msa), a crucial bioinformatics tool used in various applications such as family and domain classification, pattern identification, structure prediction, and phylogeny. Different methods for performing msas, including full dynamic programming, progressive alignment using clustalw and tcoffee, and iterative methods. It also covers the importance of conservation patterns and psi-blast alignments. Examples of clustalw input and output formats and discusses the criteria for a good msa.
Typology: Study notes
1 / 22
This page cannot be seen from the preview
Don't miss anything!















BME 110: CompBio Tools Todd Lowe April 22, 2008
Multiple sequence alignment is probably the single-most important bioinformatics tools.
Many applications require accurate MSAs - PSIBLAST - Family and domain classification - Pattern identification - Structure prediction - secondary structure • fold recognition - Phylogeny - Full-genome alignments in browsers
The goal of BLAST is rapid detection bydetecting high-scoring local alignments. Itdoesn’t necessarily find the optimal global orlocal alignment
Profiles throw away information for regions thatare insertions relative to the query
Full Dynamic Programming - Gives the optimal solution, but prohibitively slow and memory intensive for >6-8 sequences - MSA program - Progressive Alignment - ClustalW - http://www.ebi.ac.uk/clustalw/index.html (most commonly used) - Tcoffee - http://igs-server.cnrs-mrs.fr/Tcoffee/ (a little better, but slower) - Iterative - better than progressive methods, but slower - Dialign - HMMs
Input: 5 sequences detected by BLASTp using human SNAP-25as a query - Default parameters, output order: input >sp_P13795 MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKD MKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTND ARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG >gi_31242623 MPAAAPPAENGAAVPKTELQELQMKQQQVVDESLDSTRRMLALCEESTEVGMRTIVMLDEQGEQLDRIEE GMDQINADMREAEKNLSGMEKCCGICVLPCNKSASFKEDDGTWKGNDDGKVVNNQPQRVMDDRNGLGPQA GYIGRITNDAREDEMEENMGQVNTMIGNLRNMALDMGSELENQNRQIDRINRKGDSNATRIAAANERAHD LLK >gi_3822409 MPTTAEPAQENGAPRSELQELQLKAGQVTDETLESTRRMLALCEESKEAGIRTLVALDDQGEQLERIEEN MDQINADMKEAEKNLTGMEKFCGLCVLPWNKSAPFKENEDAWKGNDDGKVVNNQPQRVMDDGSGLGPQGG YIGRITNDAREDEMEENVGQVNTMIGNLRNMAIDMGSELENQNRQIDRIKNKAEM >gi_39593308 MSARRGAPGGQRHPRPYAVEPTVDINGLVLPADMSDELKGLNVGIDEKTIESLESTRRMLALCEESKEAG IKTLVMLDDQGEQLERCEGALDTINQDMKEAEDHLKGMEKCCGLCVLPWNKTDDFEKNSEYAKAWKKDDD GGVISDQPRITVGDPTMGPQGGYITKITNDAREDEMDENIQQVSTMVGNLRNMAIDMSTEVSNQNRQLDR IHDKAQSNEVRVESANKRAKNLITK >gi_32567202 MSGDDDIPEGLEAINLKMNATTDDSLESTRRMLALCEESKEAGIKTLVMLDDQGEQLERCEGALDTINQD MKEAEDHLKGMEKCCGLCVLPWNKTDDFEKTEFAKAWKKDDDGGVISDQPRITVGDSSMGPQGGYITKIT NDAREDEMDENVQQVSTMVGNLRNMAIDMSTEVSNQNRQLDRIHDKAQSNEVRVESANKRAKNLITK
FASTA format
Download from NCBI, ExPASy, EBI, Pfam … - Sequence names should be - Unique - 15 characters or less - Comprised of only A-Z,a-z,0-9 and _ (Do not use #$%@|*!:;. or spaces)
The guide tree shows the distances between sequences obtained fromthe initial pairwise alignments - This is the order that sequences were added into the MSA - Guide tree is not a phylogenetic tree (it’s just a rough estimate of similarity), however a true phylogenetic tree can be generated aftermaking an alignment
Greedy algorithm
Breaks problem up into smaller problems - Finds best solution to each small problem - Combine solutions to get answer to whole problem - Not necessarily the global answer - Doesn’t use all information in solving sub-problems - Suboptimal answers for small problems may combine togive a better overall answer - Gaps: once created, they stay as part of alignmentfor rest of alignment iterations
Most common output formats for MSAs areinterleaved:
MSF, ASN, BLAST query-anchored formats - All sequences are stacked up, and chopped intoblocks of ~60 residues - Easy for humans to read, but difficult to edit - Tools for converting formats are available on theweb ReadSeq at Baylor College of Medicine HGSC: http://searchlauncher.bcm.tmc.edu/seq-util/Options/readseq.html
SN29_RAT/142-196 PSSRLKEAINTSKDQESKYQASHPNLRRLHDAE---LDSVPASTV----NTEVY-----P KNSSL---R-----A >SN29_HUMAN/142-197 PNNRLKEAISTSKEQEAKYQASHPNLR-------KLDDTDPVPRGA---GSAMSTDA-YP KNPHL---R-----A >SN25_TORMA/95-148 PCNK----LKNFEAGGAYKKVWGNNQD------G-VVASQP-ARVMD-DREQMA-----M SGGYI--RRI-TDDA >O93578/11-59 PCNK----MKS-----GASKAWGNNQD------G-VVASQP-ARVVD-EREQMA-----I SGGFI--RRV-TDDA >SN25_DROME/98-149 PCNK----SQSFK---EDDGTWKGNDD------GKVVNNQP-QRVMD-DRNGM-----MA QAGYI--GRI-TNDA • Uppercase and ‘-’ characters are alignment columns. There must be thesame number of aligned characters in all sequences.
Insertions that are not part of the alignment, are indicated with lowercase and ‘.’ characters. These are not read (i.e. they’re for humansonly) - Benefits - Easily machine readable - Readable by most programs that read FASTA format
Logos are another useful visualization of alignments that allowconserved positions to be easily picked out. - Multiple tools available on the web or can be downloaded: - http://weblogo.berkeley.edu
Makes a library of pair-wise global and severallocal alignments
Tries to find a multiple alignment that has bestconsensus with all alignments in the library. - Still a progressive algorithm - Slower, but usually a bit better than ClustalW
Most methods align proteins on the basis of sequencesimilarity, but what we really want to know is: - Evolutionary similarity - Functional similarity - Structural similarity - If the sequences are closely related, these similarities areall equivalent. As sequences become more divergent,theses similarities may not be equivalent. - There isn’t necessarily one ‘correct’ alignment for a family.MSA doesn’t necessarily reflect a true structural or functional alignment.
Don’t include too many
Problems are VERY slow for many sequences - Start with 10-15 or so. - Closely related sequences are easy to align, butless informative. The converse is true for moredistantly related sequences - No identical sequences - Each sequence 30-70% identical with at least half of theother sequences.