

















Study with the several resources on Docsity
Earn points by helping other students or get them with a premium plan
Prepare for your exams
Study with the several resources on Docsity
Earn points to download
Earn points by helping other students or get them with a premium plan
Rajaram Purshotam Joshi delivered this lecture at All India Institute of Medical Sciences for Biogenetics and Computers course. It includes: Alignment, File, Format, Protein, Code, Line, Identifier, Specification, Identifier, Residue, Chain, Crystallographic
Typology: Slides
1 / 25
This page cannot be seen from the preview
Don't miss anything!


















P1;5fd structureX:5fd1:1 : :106 : :ferredoxin:Azotobacter vinelandii: 1.90: 0. AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAI FSEDEVPEDMQEFIQLNAELA EVWPNITEKKDPLPDAEDWDGVKGKLQHLER*
First line: Specifies the protein code after the >P1; line identifier.
Second line:
Field 1: A specification whether structure is available or not.
valid values: structureX, structureM, structure, sequence
Field 2: PDB Code
Field 3-6: identifiers for the first residue, chain id, last residue and its chain id.
Field 7: Protein Name
Field 8: Source of Protein
Field 9: Resolution of crystallographic analysis
Field 10: R-Factor
Residue Numbers:
Any real number or one of the following
:
FIRST: means first residue number LAST: means last residue number END: Last Residue in PDB file @ will match any residue number and chain id @:@ first residue of first chain
Chain Ids:
Actual Chain ids or @: meaning any chain
Template format of second line
the template structures must have at least the first two fields specified
Eg:
Target Format of Second Line
the target sequence must have the first field filled in.
a = automodel(env,
alnfile = 'TvLDH-4mdhA.ali', # alignment filename
knowns = '4mdhA', # codes of the templates
sequence = 'TvLDH') # code of the target
creating an automodel object and
setting any desired parameters, to then
go ahead and build all models.
a.make()
check_ali___> Checking pairwise structural superpositions.
Equivalent CA pairs with distance difference larger than 6. angstroms:
ALN_POS TMPL1 TMPL2 RID1 RID2 NAM1 NAM2 DIST
337 1 2 332 324 I A 11. 95 2 3 90 96 K G 6. 96 2 3 91 97 N P 7. 97 2 3 92 98 A G 7. 98 2 3 93 99 A M 7. 99 2 3 94 100 K E 6. 337 2 3 324 329 A G 9.
END OF TABLE
check_ali___> Checking the sequence-structure alignment.
runcmd______> alignment.check() check_a_343_> >> BEGINNING OF COMMAND openf5__224_> Open 11 OLD SEQUENTIAL ./\4mdhA.pdb Dynamically allocated memory at amaxstructure [B,kB,MB]: 2645671 2583.663 2. openf5__224_> Open 11 OLD SEQUENTIAL ./\4mdhA.pdb check_ali___> Checking the sequence-structure alignment. Implied target CA(i)-CA(i+1) distances longer than 8.0 angstroms: ALN_POS TMPL RID1 RID2 NAM1 NAM2 DIST
END OF TABLE check_a_344_> << END OF COMMAND
Alignment position template residue id 1 residue id 2 name1 name2 dist